PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P21350_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 401aa    MW: 45328.5 Da    PI: 5.059
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P21350_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS313.74e-96314003374
                   GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            elL ecA+a+s++d  ++++lL+ l+elasp+gd  q+la+yf++AL  + ++s++++yk+  + ++ +++ +++ ++   f+evsP+
  GSMUA_Achr6P21350_001  31 ELLRECARAISEKDSGKIHRLLWMLNELASPYGDCEQKLASYFLQALFCKATESGERCYKTSLSVAEMSHSFESTRKVILQFQEVSPW 118
                            7999********************************************************986666665555555566666******* PP

                   GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                             +f+h + N aIlea+ege ++HiiD++ ++++QWp+Ll+aLa+R++++p+lR+T+v+  + +    + e+g+r+ +fA+ +gvpfef
  GSMUA_Achr6P21350_001 119 TTFGHAASNGAILEALEGEAKLHIIDISNTYCTQWPTLLEALATRNDDSPHLRLTVVAT-AGVGGFVMDEIGQRMGRFARLMGVPFEF 205
                            ***********************************************************.55699*********************** PP

                   GRAS 179 nvl.vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflealey 263
                            +v+   +rl++l+ eeL +++gEa+aVn++ +l r+      +e +r+++++++++l+P+vv+vve+ead    s++F+  f e+l++
  GSMUA_Achr6P21350_001 206 HVIrDLSRLDELREEELGLREGEAVAVNCIGALRRVG-----VE-QRQAFIRMLRTLRPRVVTVVEEEADFtsCSGEFAVCFDECLRF 287
                            **85566*****************************8.....44.488********************99954578************ PP

                   GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg 348
                            y++ +++le+++p++s+er  +Ere  +r+i  v+ac g++    er+e+ ++W +rl ea F++ ++s++++++ k+ll+++  ++ 
  GSMUA_Achr6P21350_001 288 YTTYLETLEESFPPTSNERLALERE-CSRSILRVLACDGDRvgDCERREKGSQWCRRLIEA-FSSNSFSDDVVDDLKALLKRYRaGWS 373
                            *************************.89***********9876789************998.*********************95333 PP

                   GRAS 349 .yrveeesgslvlgWkdrpLvsvSaWr 374
                             +  e +   l+l+Wk++p+v+++aW+
  GSMUA_Achr6P21350_001 374 lMPAEGDASGLYLTWKQQPVVWACAWK 400
                            244556777888**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.9373378IPR005202Transcription factor GRAS
PfamPF035141.4E-9331400IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MQNPHPHHHQ ASASCLLELD DPDATEKWAA ELLRECARAI SEKDSGKIHR LLWMLNELAS  60
PYGDCEQKLA SYFLQALFCK ATESGERCYK TSLSVAEMSH SFESTRKVIL QFQEVSPWTT  120
FGHAASNGAI LEALEGEAKL HIIDISNTYC TQWPTLLEAL ATRNDDSPHL RLTVVATAGV  180
GGFVMDEIGQ RMGRFARLMG VPFEFHVIRD LSRLDELREE ELGLREGEAV AVNCIGALRR  240
VGVEQRQAFI RMLRTLRPRV VTVVEEEADF TSCSGEFAVC FDECLRFYTT YLETLEESFP  300
PTSNERLALE RECSRSILRV LACDGDRVGD CERREKGSQW CRRLIEAFSS NSFSDDVVDD  360
LKALLKRYRA GWSLMPAEGD ASGLYLTWKQ QPVVWACAWK P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-25334008375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009405573.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF71e-141SHR_ARATH; Protein SHORT-ROOT
TrEMBLM0T8Y30.0M0T8Y3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P21350_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35263781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-120GRAS family protein